PDK2 Antibody - middle region

Référence ARP31778_P050-25UL

Conditionnement : 25ul

Marque : Aviva Systems Biology

Demander plus d'informations

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

PDK2 Antibody - middle region (ARP31778_P050)

Datasheets/ManualsPrintable datasheet for anti-PDK2 (ARP31778_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Paraffin embedded heart tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PDK2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 77%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%; Zebrafish: 77%
Peptide SequenceSynthetic peptide located within the following region: ELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKI
Concentration0.5 mg/ml
Blocking PeptideFor anti-PDK2 (ARP31778_P050) antibody is Catalog # AAP31778 (Previous Catalog # AAPP02569)
Sample Type Confirmation

PDK2 is supported by BioGPS gene expression data to be expressed in HEK293T

ReferenceHiromasa,Y., (2008) Biochemistry 47 (8), 2312-2324
Gene SymbolPDK2
Gene Full NamePyruvate dehydrogenase kinase, isozyme 2
Alias SymbolsPDHK2, PDKII
NCBI Gene Id5164
Protein Name[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial
Description of TargetPDK2 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.
Uniprot IDQ15119
Protein Accession #NP_002602
Nucleotide Accession #NM_002611
Protein Size (# AA)407
Molecular Weight44kDa
Protein InteractionsVSIG4; DLAT; ISOC2; HIC2; SGK1; PDK2; PDK1; PDHA1; PDHX; AKT1; HTT;