RBM35A antibody - N-terminal region
Référence ARP42489_T100
Conditionnement : 100ul
Marque : Aviva Systems Biology
RBM35A Antibody - N-terminal region (ARP42489_T100)
Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/Manuals | Printable datasheet for anti-ESRP1 (ARP42489_T100) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RBM35A |
Purification | Protein A purified |
Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Peptide Sequence | Synthetic peptide located within the following region: MTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKF |
Concentration | 1.0 mg/ml |
Blocking Peptide | For anti-ESRP1 (ARP42489_T100) antibody is Catalog # AAP42489 (Previous Catalog # AAPS12903) |
Sample Type Confirmation | ESRP1 is supported by BioGPS gene expression data to be expressed in HCT116 |
Gene Symbol | ESRP1 |
---|---|
Gene Full Name | Epithelial splicing regulatory protein 1 |
Alias Symbols | RBM35A, RMB35A, DFNB109 |
NCBI Gene Id | 54845 |
Protein Name | Epithelial splicing regulatory protein 1 |
Description of Target | The function remains unknown. |
Uniprot ID | Q6NXG1-2 |
Protein Accession # | NP_001116297 |
Nucleotide Accession # | NM_001034915 |
Protein Size (# AA) | 608 |
Molecular Weight | 68kDa |
Protein Interactions | ATXN1; RNF2; BMI1; UBC; |