Specifications

Product Data
Applications	IHC, WB
Recommended Dilution	WB, IHC
Reactivities	Mouse, Human
Host	Rabbit
Isotype	IgG
Clonality	Polyclonal
Immunogen	The immunogen for anti-Tfam antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage	Store at -20°C as received.
Stability	Stable for 12 months from date of receipt.
Predicted Protein Size	28 kDa
Gene Name	transcription factor A, mitochondrial
Database Link	NP_033386 Entrez Gene 7019 HumanEntrez Gene 21780 Mouse UniProt ID P40630
Background	The function remains unknown.
Synonyms	MTTF1; MtTF1; MTTFA; mtTFA; OTTHUMP00000019633; TCF6; TCF6L1; TCF6L2; TCF6L3
Note	Immunogen Sequence Homology: Mouse: 100%
Reference Data