UGT1A6 Antibody - C-terminal region : Biotin
Référence ARP41458_P050-Biotin
Conditionnement : 100ul
Marque : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-UGT1A6 (ARP41458_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB, IHC |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human UGT1A6 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 92% |
Peptide Sequence | Synthetic peptide located within the following region: APHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGK |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-UGT1A6 (ARP41458_P050) antibody is Catalog # AAP41458 (Previous Catalog # AAPS09204) |
Reference | Berkhout,M., (2008) Br J Surg 95 (4), 499-505 |
---|---|
Gene Symbol | UGT1A6 |
Gene Full Name | UDP glucuronosyltransferase 1 family, polypeptide A6 |
Alias Symbols | GNT1, UGT1, HLUGP, UDPGT, UGT1A, UGT1C, UGT1E, UGT1F, HLUGP1, UGT-1A, UGT-1C, UGT-1E, UGT-1F, UGT1.1, UGT1.3, UGT1.5, UGT1.6, UGT1A1, UGT1A3, UGT1A5, UGT1-01, UGT1-03, UGT1-05, UGT1-06, UGT1A6S, hUG-BR1, UDPGT 1-6 |
NCBI Gene Id | 54578 |
Protein Name | UDP-glucuronosyltransferase 1-6 |
Description of Target | UGT1A6 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme is active on phenolic and planar compounds. Alternative splicing in the unique 5' end of this gene results in two transcript variants.This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene is active on phenolic and planar compounds. Alternative splicing in the unique 5' end of this gene results in two transcript variants. |
Uniprot ID | P19224 |
Protein Accession # | NP_001063 |
Nucleotide Accession # | NM_001072 |
Protein Size (# AA) | 532 |
Molecular Weight | 58kDa |