C2orf33 Antibody - C-terminal region : Biotin
Referência ARP49483_P050-Biotin
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
C2orf33 Antibody - C-terminal region (ARP49483_P050)
| Datasheets/Manuals | Printable datasheet for anti-MFF (ARP49483_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human C2orf33 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: VVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLW |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-MFF (ARP49483_P050) antibody is Catalog # AAP49483 (Previous Catalog # AAPS25106) |
| Reference | Gregory,S.G., (2008) Mol. Biol. Cell 19 (6), 2402-2412 |
|---|---|
| Gene Symbol | MFF |
| Gene Full Name | Mitochondrial fission factor |
| Alias Symbols | EMPF2, GL004, C2orf33 |
| NCBI Gene Id | 56947 |
| Protein Name | Mitochondrial fission factor |
| Description of Target | The exact function of C2orf33 remains unknown. |
| Uniprot ID | Q9GZY8 |
| Protein Accession # | NP_064579 |
| Nucleotide Accession # | NM_020194 |
| Protein Size (# AA) | 342 |
| Molecular Weight | 38kDa |
| Protein Interactions | MFF; DNM1L; YWHAQ; UBC; DDX28; ILF3; |
