Clinisciences > CD81 Antibody - C-terminal region
CD81 Antibody - C-terminal region
Referência ARP63231_P050
Tamanho : 100ul
Marca : Aviva Systems Biology
Solicitar mais informações
Por favor, faça login para usar este recurso.
Datasheets/Manuals | Printable datasheet for anti-CD81 (ARP63231_P050) antibody |
---|
Tested Species Reactivity | Human | ||
---|---|---|---|
Predicted Species Reactivity | Human, Cow, Dog, Goat, Horse, Pig, Sheep | ||
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | ||
Clonality | Polyclonal | ||
Host | Rabbit | ||
Application | WB, IHC | ||
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. | ||
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human CD81 | ||
Purification | Affinity Purified | ||
Predicted Homology Based on Immunogen Sequence | Cow: 83%; Dog: 93%; Goat: 83%; Horse: 75%; Human: 100%; Pig: 86%; Sheep: 92% | ||
Peptide Sequence | Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE | ||
Concentration | 0.5 mg/ml | ||
Blocking Peptide | For anti-CD81 (ARP63231_P050) antibody is Catalog # AAP63231 | ||
Enhanced Validation |
|
Gene Symbol | CD81 |
---|---|
Gene Full Name | CD81 molecule |
Alias Symbols | S5.7, CVID6, TAPA1, TSPAN28 |
NCBI Gene Id | 975 |
Protein Name | CD81 antigen |
Description of Target | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies. Two transcript variants encoding different isoforms have been found for this gene. |
Uniprot ID | P60033 |
Protein Accession # | NP_001284578.1 |
Nucleotide Accession # | NM_001297649.1 |
Protein Size (# AA) | 274 |
Molecular Weight | 30 kDa |
Protein interactions
Name | # of Products |
---|---|
CD19 | 68 |
CD4 | 497 |
CD46 | 77 |
CD63 | 61 |
CD81 | 115 |
CD9 | 120 |
CR2 | 96 |
DLG5 | 16 |
Gag | 136 |
HCVgp1 | 103 |
IFITM1 | 50 |
IGSF8 | 37 |
INO80B | 24 |
ITGA4 | 61 |
ITGB1 | 292 |
KIT | 106 |
MYOC | 144 |
PTGFRN | 43 |
RBBP6 | 100 |
Rnf128 | 41 |
SHC1 | 492 |
TSPAN4 | 59 |
UBC | 7030 |
ZBTB16 | 145 |
Biological pathways
Name | # of Products |
---|---|
Activation of MAPK activity | 317 |
Cell proliferation | 731 |
Phosphatidylinositol biosynthetic process | 40 |
Positive regulation of 1-phosphatidylinositol 4-kinase activity | 15 |
Positive regulation of cell proliferation | 582 |
Positive regulation of peptidyl-tyrosine phosphorylation | 308 |
Protein localization | 38 |
Regulation of immune response | 318 |
Virion attachment, binding of host cell surface receptor | 31 |
Biological process
Name | # of Products |
---|---|
Activation of MAPK activity | 105 |
Cell proliferation | 293 |
Entry of virus into host cell | 8 |
Interspecies interaction between organisms | 281 |
Phosphatidylinositol biosynthetic process | 14 |
Phosphatidylinositol metabolic process | 15 |
Positive regulation of 1-phosphatidylinositol 4-kinase activity | 2 |
Positive regulation of cell proliferation | 483 |
Positive regulation of peptidyl-tyrosine phosphorylation | 112 |
Protein localization | 50 |
Regulation of growth | 66 |
Regulation of immune response | 89 |
Response to wounding | 70 |
Virion attachment, binding of host cell surface receptor | 6 |
Cellular components
Name | # of Products |
---|---|
Apical plasma membrane | 173 |
Immunological synapse | 24 |
Integral to plasma membrane | 817 |
Plasma membrane | 2678 |
Protein function
Name | # of Products |
---|---|
Protein binding | 12191 |
- CD81 Antibody (OAEE00320)Catalog #: OAEE00320Clone: M38Application: FC, IF, IHC, IP, WBFormat: Phosphate buffered saline (PBS), pH 7.4, 15 mM sodium azideSize: 100UG
- CD81 Antibody (OAGA01703)Catalog #: OAGA01703Application: Blk, InhFormat: Liquid 1XPBS, 20% glycerol (pH 7) with 0.01% Thimerosal added as a preservativeSize: 100 ul
- CD81 ELISA Kit (Human) (OKCD00819)Catalog #: OKCD00819Application: ELISA-SandwichKit Range: 0.312-20ng/mLSensitivity: < 0.115 ng/mLSize: 96WELLS
- CD81 Antibody (OACD01081)Catalog #: OACD01081Application: ICC|IHC|IP|WBFormat: Liquid. 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.