CD81 Antibody - C-terminal region
Referência ARP63231_P050-25UL
Tamanho : 25ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
| Datasheets/Manuals | Printable datasheet for anti-CD81 (ARP63231_P050) antibody |
|---|
| Tested Species Reactivity | Human | ||
|---|---|---|---|
| Predicted Species Reactivity | Human, Cow, Dog, Goat, Horse, Pig, Sheep | ||
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | ||
| Clonality | Polyclonal | ||
| Host | Rabbit | ||
| Application | WB, IHC | ||
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. | ||
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human CD81 | ||
| Purification | Affinity Purified | ||
| Predicted Homology Based on Immunogen Sequence | Cow: 83%; Dog: 93%; Goat: 83%; Horse: 75%; Human: 100%; Pig: 86%; Sheep: 92% | ||
| Peptide Sequence | Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE | ||
| Concentration | 0.5 mg/ml | ||
| Blocking Peptide | For anti-CD81 (ARP63231_P050) antibody is Catalog # AAP63231 | ||
| Enhanced Validation |
|
| Gene Symbol | CD81 |
|---|---|
| Gene Full Name | CD81 molecule |
| Alias Symbols | S5.7, CVID6, TAPA1, TSPAN28 |
| NCBI Gene Id | 975 |
| Protein Name | CD81 antigen |
| Description of Target | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies. Two transcript variants encoding different isoforms have been found for this gene. |
| Uniprot ID | P60033 |
| Protein Accession # | NP_001284578.1 |
| Nucleotide Accession # | NM_001297649.1 |
| Protein Size (# AA) | 274 |
| Molecular Weight | 30 kDa |
-
What is the species homology for "CD81 Antibody - C-terminal region (ARP63231_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Cow, Dog, Goat, Horse, Pig, Sheep".
-
How long will it take to receive "CD81 Antibody - C-terminal region (ARP63231_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "CD81 Antibody - C-terminal region (ARP63231_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "CD81 Antibody - C-terminal region (ARP63231_P050)"?
This target may also be called "S5.7, CVID6, TAPA1, TSPAN28" in publications.
-
What is the shipping cost for "CD81 Antibody - C-terminal region (ARP63231_P050)"?
The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.
-
What is the guarantee for "CD81 Antibody - C-terminal region (ARP63231_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "CD81 Antibody - C-terminal region (ARP63231_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "30 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "CD81 Antibody - C-terminal region (ARP63231_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "CD81"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "CD81"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "CD81"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "CD81"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "CD81"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "CD81"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.