| Sequence | NH2-YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR-COOH |
|---|
| Format | Peptides are lyophilized in a solid powder format. Peptides can be reconstituted in solution using the appropriate buffer as needed. |
|---|---|
| Storage | Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C. |
| Precautions | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |