Ctsd Antibody - C-terminal region : HRP

Referência ARP41481_P050-HRP

Tamanho : 100ul

Marca : Aviva Systems Biology

Solicitar mais informações

Contactar o distribuidor local :


Telefone : +1 850 650 7790
Datasheets/ManualsPrintable datasheet for anti-Ctsd (ARP41481_P050) antibody
Product Info
Publications

The late endocytic Rab39a GTPase regulates the interaction between multivesicular bodies and chlamydial inclusions. J. Cell. Sci. 128, 3068-81 (2015). 26163492

Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 79%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 93%; Yeast: 92%; Zebrafish: 92%
Peptide SequenceSynthetic peptide located within the following region: KTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVGFANAVVL
Concentration0.5 mg/ml
Blocking PeptideFor anti-Ctsd (ARP41481_P050) antibody is Catalog # AAP41481 (Previous Catalog # AAPS09403)
Gene SymbolCtsd
Gene Full NameCathepsin D
Alias SymbolsCD, Cat, CatD
NCBI Gene Id13033
Protein NameCathepsin D
Description of TargetCtsd is an acid protease active in intracellular protein breakdown.
Uniprot IDP18242
Protein Accession #NP_034113
Nucleotide Accession #NM_009983
Protein Size (# AA)410
Molecular Weight45kDa
  1. What is the species homology for "Ctsd Antibody - C-terminal region (ARP41481_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish".

  2. How long will it take to receive "Ctsd Antibody - C-terminal region (ARP41481_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Ctsd Antibody - C-terminal region (ARP41481_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Ctsd Antibody - C-terminal region (ARP41481_P050)"?

    This target may also be called "CD, Cat, CatD" in publications.

  5. What is the shipping cost for "Ctsd Antibody - C-terminal region (ARP41481_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "Ctsd Antibody - C-terminal region (ARP41481_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Ctsd Antibody - C-terminal region (ARP41481_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "45kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Ctsd Antibody - C-terminal region (ARP41481_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CTSD"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CTSD"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CTSD"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CTSD"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CTSD"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CTSD"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.