Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

DAF monoclonal antibody (M01), clone 1G3 Western Blot analysis of DAF expression in HeLa ( Cat # L013V1 ).

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of CD55 expression in transfected 293T cell line by DAF monoclonal antibody (M01), clone 1G3.

Lane 1: CD55 transfected lysate(41.4 KDa).
Lane 2: Non-transfected lysate.

Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged DAF is approximately 0.03ng/ml as a capture antibody.

<em>In situ</em> Proximity Ligation Assay (Cell)
Application

In situ Proximity Ligation Assay (Cell)

Proximity Ligation Analysis of protein-protein interactions between LCK and CD55. HeLa cells were stained with anti-LCK rabbit purified polyclonal 1:1200 and anti-CD55 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

QC Test

Western Blot detection against Immunogen (36.74 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant DAF.

    Immunogen

    DAF (NP_000565, 35 a.a. ~ 134 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLRGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYR

    Host

    Mouse

    Reactivity

    Human

    Isotype

    IgG1 Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (36.74 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Cell lysate)

    DAF monoclonal antibody (M01), clone 1G3 Western Blot analysis of DAF expression in HeLa ( Cat # L013V1 ).

    Western Blot (Transfected lysate)

    Western Blot analysis of CD55 expression in transfected 293T cell line by DAF monoclonal antibody (M01), clone 1G3.

    Lane 1: CD55 transfected lysate(41.4 KDa).
    Lane 2: Non-transfected lysate.

    Western Blot (Recombinant protein)

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged DAF is approximately 0.03ng/ml as a capture antibody.

    ELISA

    In situ Proximity Ligation Assay (Cell)

    Proximity Ligation Analysis of protein-protein interactions between LCK and CD55. HeLa cells were stained with anti-LCK rabbit purified polyclonal 1:1200 and anti-CD55 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • Gene Info — CD55

    Entrez GeneID

    1604

    GeneBank Accession#

    NM_000574

    Protein Accession#

    NP_000565

    Gene Name

    CD55

    Gene Alias

    CR, CROM, DAF, TC

    Gene Description

    CD55 molecule, decay accelerating factor for complement (Cromer blood group)

    Omim ID

    125240

    Gene Ontology

    Hyperlink

    Gene Summary

    This gene encodes a protein involved in the regulation of the complement cascade. The encoded glycoprotein is also known as the decay-accelerating factor (DAF); binding of DAF to complement proteins accelerates their decay, disrupting the cascade and preventing damage to host cells. Antigens present on the DAF glycoprotein constitute the Cromer blood group system (CROM). Two alternatively spliced transcripts encoding different proteins have been identified. The predominant transcript encodes a membrane-bound protein expressed on cells exposed to plasma component proteins but an alternatively spliced transcript produces a soluble protein present at much lower levels. Additional, alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq

    Other Designations

    CD55 antigen|decay accelerating factor for complement

  • Interactome
  • Pathway
  • Disease
  • Publication Reference