DMRT1 Antibody - N-terminal region : FITC
Referência P100722_P050-FITC
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
DMRT1 Antibody - N-terminal region (P100722_P050)
| Datasheets/Manuals | Printable datasheet for anti-DMRT1 (P100722_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Cow, Dog, Pig, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human DMRT1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 78%; Dog: 85%; Human: 100%; Pig: 78%; Rabbit: 92% |
| Peptide Sequence | Synthetic peptide located within the following region: PNDEAFSKPSTPSEAPHAPGVPPQGRAGGFGKASGALVGAASGSSAGGSS |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-DMRT1 (P100722_P050) antibody is Catalog # AAP30990 (Previous Catalog # AAPP01721) |
| Reference | Cheng,H.H., (2006) Cell Res. 16 (4), 389-393 |
|---|---|
| Gene Symbol | DMRT1 |
| Gene Full Name | Doublesex and mab-3 related transcription factor 1 |
| Alias Symbols | DMT1, CT154 |
| NCBI Gene Id | 1761 |
| Protein Name | Doublesex- and mab-3-related transcription factor 1 |
| Description of Target | The gene encodes the DMRT1 protein is found in a cluster with two other members of the gene family, having in common a zinc finger-like DNA-binding motif (DM domain). The DM domain is an ancient, conserved component of the vertebrate sex-determining pathway that is also a key regulator of male development in flies and nematodes. This gene exhibits a gonad-specific and sexually dimorphic expression pattern. Defective testicular development and XY feminization occur when this gene is hemizygous. This suggested that DMRT1 may be required for testis development.This gene is found in a cluster with two other members of the gene family, having in common a zinc finger-like DNA-binding motif (DM domain). The DM domain is an ancient, conserved component of the vertebrate sex-determining pathway that is also a key regulator of male development in flies and nematodes. This gene exhibits a gonad-specific and sexually dimorphic expression pattern. Defective testicular development and XY feminization occur when this gene is hemizygous. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Uniprot ID | Q9Y5R6 |
| Protein Accession # | NP_068770 |
| Nucleotide Accession # | NM_021951 |
| Protein Size (# AA) | 373 |
| Molecular Weight | 39kDa |
| Protein Interactions | Dlg4; TRIM29; |
