DSCR1L1 (RCAN2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommended Dilution	WB
Reactivities	Human
Host	Rabbit
Isotype	IgG
Clonality	Polyclonal
Immunogen	The immunogen for anti-RCAN2 antibody: synthetic peptide directed towards the middle region of human RCAN2. Synthetic peptide located within the following region: LHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage	Store at -20°C as received.
Stability	Stable for 12 months from date of receipt.
Predicted Protein Size	22 kDa
Gene Name	regulator of calcineurin 2
Database Link	NP_005813 Entrez Gene 10231 Human UniProt ID Q14206
Background	RCAN2 inhibits calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. RCAN2 could play a role during central nervous system development.
Synonyms	CSP2; DSCR1L1; MCIP2; RCN2; ZAKI-4; ZAKI4
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data