EIF2B5 antibody - N-terminal region
Referência ARP61329_P050
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
EIF2B5 Antibody - N-terminal region (ARP61329_P050)
| Datasheets/Manuals | Printable datasheet for anti-EIF2B5 (ARP61329_P050) antibody |
|---|
| Publications | Cellular eIF2B subunit localization: implications for the integrated stress response and its control by small molecule drugs. Mol Biol Cell. 30, 942-958 (2019). 30726166 Stoichiometry of the eIF2B complex is maintained by mutual stabilization of subunits. Biochem. J. 473, 571-80 (2016). 26614765 |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Rat, Cow, Dog, Horse |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 85%; Dog: 92%; Horse: 85%; Human: 100%; Rat: 85% |
| Peptide Sequence | Synthetic peptide located within the following region: GVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPI |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-EIF2B5 (ARP61329_P050) antibody is Catalog # AAP61329 (Previous Catalog # AAPP47461) |
| Subunit | epsilon |
| Gene Symbol | EIF2B5 |
|---|---|
| Gene Full Name | Eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa |
| Alias Symbols | CLE, CACH, LVWM, EIF-2B, EIF2Bepsilon |
| NCBI Gene Id | 8893 |
| Protein Name | Translation initiation factor eIF-2B subunit epsilon |
| Description of Target | This gene encodes one of five subunits of eukaryotic translation initiation factor 2B (EIF2B), a GTP exchange factor for eukaryotic initiation factor 2 and an essential regulator for protein synthesis. Mutations in this gene and the genes encoding other EIF2B subunits have been associated with leukoencephalopathy with vanishing white matter. |
| Uniprot ID | Q13144 |
| Protein Accession # | NP_003898 |
| Nucleotide Accession # | NM_003907 |
| Protein Size (# AA) | 721 |
| Molecular Weight | 80 kDa |
| Protein Interactions | UBC; EGFR; EIF2B2; EIF2B3; EIF2B4; APP; CHMP2A; GSK3A; GSK3B; EIF2S2; CSNK1A1; CSNK2A2; CSNK2A1; EIF2B1; |
