ELOC Antibody - middle region : HRP
Referência P100962_T100-HRP
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
ELOC Antibody - middle region (P100962_T100)
| Datasheets/Manuals | Printable datasheet for anti-ELOC (P100962_T100) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Dog, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TCEB1 |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Dog: 100%; Human: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: AENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALE |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-ELOC (P100962_T100) antibody is Catalog # AAP31320 (Previous Catalog # AAPP02070) |
| Sample Type Confirmation | TCEB1 is supported by BioGPS gene expression data to be expressed in Jurkat |
| Reference | Yu,X., et al., (2003) Science 302 (5647), 1056-1060 |
|---|---|
| Gene Symbol | ELOC |
| Gene Full Name | elongin C |
| Alias Symbols | SIII, TCEB1 |
| NCBI Gene Id | 6921 |
| Protein Name | elongin-C |
| Description of Target | This gene encodes the protein elongin C, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Multiple alternatively spliced transcript variants encoding two distinct isoforms have been identified. |
| Uniprot ID | Q15369 |
| Protein Accession # | NP_005639 |
| Nucleotide Accession # | NM_005648 |
| Protein Size (# AA) | 112 |
| Molecular Weight | 12kDa |
| Protein Interactions | UBC; TCEB2; FUS; vif; METTL21C; SOCS4; CUL5; PRAME; POP1; MDM2; VHL; ASB18; ASB12; ASB14; ASB15; ASB9; ASB8; ASB7; ASB5; ASB10; ASB16; ASB13; ASB1; ASB3; APEX1; CUL2; Zswim8; ASB2; CPTP; CBX5; MRAS; JTB; RCAN2; SOCS1; CUL3; WNT7B; NEDD8; HIF1A; EFNB3; CYP |
