EVX1 Antibody - N-terminal region : HRP
Referência P100830_T100-HRP
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
EVX1 Antibody - N-terminal region (P100830_T100)
| Datasheets/Manuals | Printable datasheet for anti-EVX1 (P100830_T100) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human EVX1 |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: AGSAAGPGAEPQVAGAAMLGPGPPAPSVDSLSGQGQPSSSDTESDFYEEI |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-EVX1 (P100830_T100) antibody is Catalog # AAP31183 (Previous Catalog # AAPP01926) |
| Reference | Scherer, S.W., et al., (2003) Science 300 (5620), 767-772 |
|---|---|
| Gene Symbol | EVX1 |
| Gene Full Name | Even-skipped homeobox 1 |
| Alias Symbols | EVX-1 |
| NCBI Gene Id | 2128 |
| Protein Name | Homeobox even-skipped homolog protein 1 |
| Description of Target | EVX1 is a member of the vertebrate eve-related homeo box family. This protein acts as a transcriptional repressor. A similar protein in mice is critical for early embryogenesis. |
| Uniprot ID | P49640 |
| Protein Accession # | NP_001980 |
| Nucleotide Accession # | NM_001989 |
| Protein Size (# AA) | 407 |
| Molecular Weight | 42kDa |
| Protein Interactions | RAD21; |
