ID3 Antibody - N-terminal region
Referência ARP32335_T100-25UL
Tamanho : 25ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
ID3 Antibody - N-terminal region (ARP32335_T100)
| Datasheets/Manuals | Printable datasheet for anti-ID3 (ARP32335_T100) antibody |
|---|
| Publications | Inhibitor of differentiation 4 (Id4) is a potential tumor suppressor in prostate cancer. BMC Cancer. 9, 173 (2009). 19500415 |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ID3 |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 100%; Rabbit: 100%; Rat: 93%; Sheep: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSR |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-ID3 (ARP32335_T100) antibody is Catalog # AAP32335 (Previous Catalog # AAPP03322) |
| Reference | Tsuchiya,T., (2005) Cancer Sci. 96 (11), 784-790 |
|---|---|
| Gene Symbol | ID3 |
| Gene Full Name | Inhibitor of DNA binding 3, dominant negative helix-loop-helix protein |
| Alias Symbols | HEIR-1, bHLHb25 |
| NCBI Gene Id | 3399 |
| Protein Name | DNA-binding protein inhibitor ID-3 |
| Description of Target | ID3 is a member of the ID family. The members of the family of helix-loop-helix (HLH) proteins lack a basic DNA-binding domain and inhibit transcription through formation of nonfunctional dimers that are incapable of binding to DNA.Members of the ID family of helix-loop-helix (HLH) proteins lack a basic DNA-binding domain and inhibit transcription through formation of nonfunctional dimers that are incapable of binding to DNA.[supplied by OMIM]. |
| Uniprot ID | Q02535 |
| Protein Accession # | NP_002158 |
| Nucleotide Accession # | NM_002167 |
| Protein Size (# AA) | 119 |
| Molecular Weight | 13kDa |
| Protein Interactions | UBC; TCF12; TCF3; TCF4; FAM74A1; ZNF626; ZNF408; RND1; PUF60; ZNF3; MLX; CNOT3; ID3; GNB2; FHL2; CSK; ATF3; CDK2; SMURF2; PRDM14; CBFA2T2; SAP30; IKBKG; E2F4; GATA4; NKX2-5; ID4; GTF2A1L; ELK4; ELK1; SREBF1; PAX5; MYF6; MYF5; MYOG; MYOD1; IFI16; HES1; RUN |
