JUN (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
- More Files
- Specifications
Product Description
Human JUN full-length ORF ( AAH68522.1, 1 a.a. - 331 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
62.1
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
- Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
- Gene Info — JUN
Entrez GeneID
3725GeneBank Accession#
BC068522.1Protein Accession#
AAH68522.1Gene Name
JUN
Gene Alias
AP-1, AP1, c-Jun
Gene Description
jun oncogene
Omim ID
165160Gene Ontology
HyperlinkGene Summary
This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies. [provided by RefSeq
Other Designations
Jun activation domain binding protein|OTTHUMP00000010036|activator protein 1|enhancer-binding protein AP1|v-jun avian sarcoma virus 17 oncogene homolog|v-jun sarcoma virus 17 oncogene homolog
- Interactomes
- Pathways
- Diseases