KLF4 (Kruppel-like Factor 4 (gut), EZF, GKLF) (FITC)
Referência 247963-FITC-100ul
Tamanho : 100ul
Marca : US Biological
247963-FITC Rabbit Anti-KLF4 (Kruppel-like Factor 4 (gut), EZF, GKLF) (FITC)
Clone Type
PolyclonalHost
mouseIsotype
IgG1,kGrade
PurifiedApplications
E IF WBAccession #
AAH29923Shipping Temp
Blue IceStorage Temp
-20°CMouse monoclonal antibody raised against a partial recombinant KLF4.||Applications: |Suitable for use in Immunofluorescence, Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|VLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRD||Storage and Stability:|Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. |Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. ||Note: Applications are based on unconjugated antibody.