Reagentes e instrumentos para imunologia, biologia celular e biologia molecular.
 
> MB Antibody - N-terminal region : Biotin

MB Antibody - N-terminal region : Biotin

Imprimir Imprimir
Please log in

Referência ARP41558_P050-Biotin

Tamanho : 100ul

Marca : Aviva Systems Biology

Solicitar mais informações

Contactar o distribuidor local :


Telefone : +1 850 650 7790
Datasheets/ManualsPrintable datasheet for anti-MB (ARP41558_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MB
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 79%; Goat: 86%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 85%; Pig: 86%; Rabbit: 86%; Rat: 79%; Sheep: 86%
Peptide SequenceSynthetic peptide located within the following region: MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHL
Concentration0.5 mg/ml
Blocking PeptideFor anti-MB (ARP41558_P050) antibody is Catalog # AAP41558 (Previous Catalog # AAPP24243)
ReferenceForsman,M., (2008) J. Surg. Res. 146 (2), 271-275
Gene SymbolMB
Gene Full NameMyoglobin
Alias SymbolsPVALB
NCBI Gene Id4151
Protein NameMyoglobin
Description of TargetThis gene encodes a member of the globin superfamily and is expressed in skeletal and cardiac muscles. The encoded protein is a haemoprotein contributing to intracellular oxygen storage and transcellular facilitated diffusion of oxygen. At least three alt
Uniprot IDP02144
Protein Accession #NP_005359
Nucleotide Accession #NM_005368
Protein Size (# AA)154
Molecular Weight17kDa
Protein InteractionsAPP; UBC; PSMD4;
Protein interactions
Name# of Products
PSMD4171
Biological process
Name# of Products
Brown fat cell differentiation24
Enucleate erythrocyte differentiation7
Heart development186
Response to hormone stimulus59
Response to hydrogen peroxide47
Response to hypoxia205
Slow-twitch skeletal muscle fiber contraction2
Transport555
Protein function
Name# of Products
Heme binding327
Metal ion binding5514
Oxygen binding126
Oxygen transporter activity30

  1. What is the species homology for "MB Antibody - N-terminal region (ARP41558_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep".

  2. How long will it take to receive "MB Antibody - N-terminal region (ARP41558_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MB Antibody - N-terminal region (ARP41558_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MB Antibody - N-terminal region (ARP41558_P050)"?

    This target may also be called "PVALB" in publications.

  5. What is the shipping cost for "MB Antibody - N-terminal region (ARP41558_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "MB Antibody - N-terminal region (ARP41558_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MB Antibody - N-terminal region (ARP41558_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "17kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MB Antibody - N-terminal region (ARP41558_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MB"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MB"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MB"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MB"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.