Mta2 Antibody - N-terminal region : Biotin

Referência ARP37167_T100-Biotin

Tamanho : 100ul

Marca : Aviva Systems Biology

Solicitar mais informações

Contactar o distribuidor local :


Telefone : +1 850 650 7790

Mta2 Antibody - N-terminal region (ARP37167_T100)

Datasheets/ManualsPrintable datasheet for anti-Mta2 (ARP37167_T100) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 93%; Horse: 100%; Human: 93%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 90%; Zebrafish: 77%
Peptide SequenceSynthetic peptide located within the following region: YSLVFDPVQKTLLADQGEIRVGCKFQAEIPDRLAEGESDNRNQQKMEMKV
Concentration1.0 mg/ml
Blocking PeptideFor anti-Mta2 (ARP37167_T100) antibody is Catalog # AAP37167 (Previous Catalog # AAPP10730)
ReferenceBlackshaw,S., PLoS Biol. 2 (9), E247 (2004)
Gene SymbolMta2
Gene Full NameMetastasis-associated gene family, member 2
Alias SymbolsMta1, mmta, mmta2, Mta1l1, Mata1l1, AW550797
NCBI Gene Id23942
Protein NameMetastasis-associated protein MTA2
Description of TargetMTA2 modulates the enzymatic activity of the histone deacetylase core complex.
Uniprot IDQ9R190
Protein Accession #NP_035972
Nucleotide Accession #NM_011842
Protein Size (# AA)668
Molecular Weight73kDa
Protein InteractionsEed; Nanog; L3mbtl2; Hdac1; Mta1; Satb2; Pou5f1; Runx1; RBBP7; RBBP4; Chd4; Mta2; Mbd3; Mbd2; Hdac2; Gata1; Sall4; Tfcp2l1; Esrrb; Zfpm1;