Outer Capsid Protein VP4, Recombinant, Rotavirus X, aa1-249, His-tag
Referência 406010-100ug
Tamanho : 100ug
Marca : US Biological
406010 Outer Capsid Protein VP4, Recombinant, Rotavirus X, aa1-249, His-tag
Clone Type
PolyclonalSwiss Prot
A9Q1L0Grade
PurifiedShipping Temp
Blue IceStorage Temp
-20°CSpike-forming protein that mediates virion attachment to the host epithelial cell receptors and plays a major role in cell penetration, determination of host range restriction and virulence. Rotavirus entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors.||Source:|Recombinant protein corresponding to aa1-249 from Rotavirus X Outer capsid protein VP4, fused to His-tag at N-terminal, expressed in Yeast.||Molecular Weight: |~30.8kD||Amino Acid Sequence:|MSLRSLLITTEAVGETTQTSDHQTSFSTRTYNEINDRPSLRVEKDGEKAYCFKNLDPVRYDTRMGEYPFDYGGQSTENNQLQFDLFTKDLMADTDIGLSDDVRDDLKRQIKEYYQQGYRAIFLIRPQNQEQQYIASYSSTNLNFTSQLSVGVNLSVLNKIQENKLHIYSTQPHIPSVGCEMITKIFRTDVDNENSLINYSVPVTVTISVTKATFEDTFVWNQNNDYPNMNYKDLIPAVTKNSIYHDVKR||Storage and Stability: |May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.