Recombinant Human C-C Motif Chemokine 27/CCL27

Referência 32-7055-50

Tamanho : 50ug

Marca : Abeomics

Solicitar mais informações

Contactar o distribuidor local :


Telefone : +1 850 650 7790

Recombinant Human C-C Motif Chemokine 27/CCL27

Available Pack Size(s)

  •   10 µg

  •  50 µg

  •  

  •  



Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of 20mM PB, 500mM NaCl, pH 7.5.
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
Gene : CCL27
Gene ID : 10850
Uniprot ID : Q9Y4X3
Source: E.coli.
MW :10.1kD.
Recombinant Human C-C Motif Chemokine 27 is produced by our E.coli expression system and the target gene encoding Phe25-Gly112 is expressed. Human Chemokine (C-C Motif) Ligand 27 (CCL27) is a small cytokine that is a member of the CC chemokine family; it is expressed in numerous tissues, including gonads, thymus, placenta and skin. CCL27 elicits its chemotactic effects by binding to the chemokine receptor CCR10. Predominantly expressed in the skin, CCL27 is associated with T cell-mediated inflammation of the skin. Human and Mouse CCL27 share 84% sequence identity in the mature form.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Secreted
Tissue Specificity: Testis, thymus, placenta, ovary and skin.
There are currently no product reviews