Rex1 (ZFP42) Rabbit Polyclonal Antibody
Referência TA345600
Tamanho : 100ul
Contactar o distribuidor local :
| Product Data | |
| Application | WB |
|---|---|
| Application | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-ZFP42 antibody: synthetic peptide directed towards the middle region of human ZFP42. Synthetic peptide located within the following region: FNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILTHANTNKNEQEG |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 35 kDa |
| Gene Name | ZFP42 zinc finger protein |
| Database Link | |
| Background | ZFP42 is a transcription factors and a specific marker of undifferentiated embryonic stem (ES) cells. |
| Synonyms | REX-1; REX1; zfp-42; ZNF754 |
| Note | Immunogen Sequence Homology: Human: 100% |
| Reference Data | |
Write Your Own Review
| Product Manuals |
| FAQs |
|
| SDS |
| Antibody Resources |
|
Related Products
Check items to add to the cart or
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.