Ribonucleotide Reductase (Ribonucleoside-Diphosphate Reductase Large Subunit, Ribonucleoside-Diphosphate Reductase Subunit M1, Ribonucleotide Reductase Large Subunit, RRM1, RR1) (PE)

Referência R2031-15B-PE-100ul

Tamanho : 100ul

Marca : US Biological

Solicitar mais informações

Contactar o distribuidor local :


Telefone : +1 850 650 7790


R2031-15B-PE Ribonucleotide Reductase (Ribonucleoside-Diphosphate Reductase Large Subunit, Ribonucleoside-Diphosphate Reductase Subunit M1, Ribonucleotide Reductase Large Subunit, RRM1, RR1) (PE)

Clone Type
Polyclonal
Host
rabbit
Source
human
Isotype
IgG
Grade
Affinity Purified
Applications
E WB
Crossreactivity
Ce Ca Hu Mo Rt Ze
Shipping Temp
Blue Ice
Storage Temp
4°C Do Not Freeze

RRM1 is one of two non-identical subunits that constitute ribonucleoside-diphosphate reductase, an enzyme essential for the production of deoxyribonucleotides prior to DNA synthesis in S phase of dividing cells. Its gene is located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocrotical carcinoma, and lung, ovarian, and breast cancer. Its gene may play a role in malignancies and disease that involve this region.||Applications: |Suitable for use in ELISA and Western Blot. Other applications have not been tested. ||Recommended Dilutions:|Optimal dilutions to be determined by researcher. ||Storage and Stability:|Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile ddH2O or PBS. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.||Note: Applications are based on unconjugated antibody.

Applications
Product Type: Pab|Isotype: IgG|Host: rabbit|Source: human|Concentration: As reported|Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).|Purity: Purified by Protein A affinity chromatography.|Immunogen: Synthetic peptide from near the N-terminal region of RRM1 (ATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHL)|Specificity: Recognizes human RRM1. Species crossreactivity: mouse, rat, dog, C. elegans and zebrafish.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Immunogen
Synthetic peptide from near the N-terminal region of RRM1 (ATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHL)
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human RRM1. Species crossreactivity: mouse, rat, dog, C. elegans and zebrafish.