RORC antibody - N-terminal region
Referência ARP59155_P050
Tamanho : 100ul
Marca : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-RORC (ARP59155_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RORC |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 86%; Dog: 79%; Goat: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 79%; Rat: 86%; Sheep: 79%; Zebrafish: 86% |
Peptide Sequence | Synthetic peptide located within the following region: KICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRN |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-RORC (ARP59155_P050) antibody is Catalog # AAP59155 |
Gene Symbol | RORC |
---|---|
Gene Full Name | RAR-related orphan receptor C |
Alias Symbols | TOR, RORG, RZRG, IMD42, NR1F3, RZR-GAMMA |
NCBI Gene Id | 6097 |
Protein Name | cDNA FLJ40675 fis, clone THYMU2021714, highly similar to NUCLEAR RECEPTOR ROR-GAMMA EMBL BAG53561.1 |
Description of Target | RORC encodes a protein which is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that RORC may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2.The protein encoded by this gene is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that this gene may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2. Two transcript variants encoding different isoforms have been found for this gene. |
Uniprot ID | P51449 |
Protein Accession # | NP_001001523 |
Nucleotide Accession # | NM_001001523 |
Protein Size (# AA) | 497 |
Molecular Weight | 56kDa |
Protein Interactions | EVI2A; NCOA6; EIF3I; CHD4; EIF4EBP1; |
-
What is the species homology for "RORC Antibody - N-terminal region (ARP59155_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish".
-
How long will it take to receive "RORC Antibody - N-terminal region (ARP59155_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "RORC Antibody - N-terminal region (ARP59155_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "RORC Antibody - N-terminal region (ARP59155_P050)"?
This target may also be called "TOR, RORG, RZRG, IMD42, NR1F3, RZR-GAMMA" in publications.
-
What is the shipping cost for "RORC Antibody - N-terminal region (ARP59155_P050)"?
The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.
-
What is the guarantee for "RORC Antibody - N-terminal region (ARP59155_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "RORC Antibody - N-terminal region (ARP59155_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "56kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "RORC Antibody - N-terminal region (ARP59155_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "RORC"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "RORC"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "RORC"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "RORC"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "RORC"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "RORC"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.