Small Proline-rich Protein 2B, Recombinant, Human, aa1-72, His-tag, Myc-tag (SPRR2B)

Referência 406040-100ug

Tamanho : 100ug

Marca : US Biological

Solicitar mais informações

Contactar o distribuidor local :


Telefone : +1 850 650 7790


406040 Small Proline-rich Protein 2B, Recombinant, Human, aa1-72, His-tag, Myc-tag (SPRR2B)

Clone Type
Polyclonal
Swiss Prot
P35325
Grade
Purified
Shipping Temp
Blue Ice
Storage Temp
-20°C

Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.||Source:|Recombinant protein corresponding to aa1-72 from Human Small Proline-rich Protein 2, fused to His-tag at N-terminal and fused to Myc-tag at C-terminal, expressed in Yeast.||Molecular Weight: |~12.0kD||AA Sequence:|MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK||Storage and Stability: |May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Applications
Source: Recombinant, Yeast|Purity: ~90% (SDS-PAGE)|Concentration: As reported |Form: Supplied as a liquid in Tris, 50% glycerol.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a liquid in Tris, 50% glycerol.
Purity
~90% (SDS-PAGE)
References
1. Structural organization and regulation of the small proline-rich family of cornified envelope precursors suggest a role in adaptive barrier function." Cabral A., Voskamp P., Cleton-Jansen A.-M., South A., Nizetic D., Backendorf C. J. Biol. Chem. 276:19231-19237(2001).