SPIB Antibody - C-terminal region : HRP
Referência ARP31422_P050-HRP
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
SPIB Antibody - C-terminal region (ARP31422_P050)
| Datasheets/Manuals | Printable datasheet for anti-SPIB (ARP31422_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SPIB |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: GQQKGNRKRMTYQKLARALRNYAKTGEIRKVKRKLTYQFDSALLPAVRRA |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-SPIB (ARP31422_P050) antibody is Catalog # AAP31422 (Previous Catalog # AAPP03080) |
| Sample Type Confirmation | SPIB is supported by BioGPS gene expression data to be expressed in Daudi |
| Reference | Geng,C.D. (2005) J. Biol. Chem. 280 (52), 43264-43271 |
|---|---|
| Gene Symbol | SPIB |
| Gene Full Name | Spi-B transcription factor (Spi-1/PU.1 related) |
| Alias Symbols | SPI-B |
| NCBI Gene Id | 6689 |
| Protein Name | Transcription factor Spi-B |
| Description of Target | SPI1 (MIM 165170) and SPIB are members of a subfamily of ETS (see ETS1; MIM 164720) transcription factors. ETS proteins share a conserved ETS domain that mediates specific DNA binding. SPIB and SPI1 bind to a purine-rich sequence, the PU box (5-prime-GAGGAA-3-prime). |
| Uniprot ID | Q01892 |
| Protein Accession # | NP_003112 |
| Nucleotide Accession # | NM_003121 |
| Protein Size (# AA) | 177 |
| Molecular Weight | 19kDa |
| Protein Interactions | TMEM37; SSB; GATA1; IRF4; MAPK3; MAPK8; CREBBP; TBP; CEBPB; RB1; SPI1; JUN; CSNK2A2; CSNK2A1; SPIB; E2F4; E2F3; E2F2; E2F1; |
