C3orf67 antibody - N-terminal region
Referência ARP50865_P050
Tamanho : 100ul
Marca : Aviva Systems Biology
C3orf67 Antibody - N-terminal region (ARP50865_P050)
Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/Manuals | Printable datasheet for ARP50865_P050 |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human C3orf67 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100% |
Peptide Sequence | Synthetic peptide located within the following region: TDIIPRSCQLMTDVPHVTQLLNMTKLRQTEIKFGGHPLRSAESDQFINRG |
Concentration | 0.5 mg/ml |
Blocking Peptide | Catalog # AAP50865 (Previous Catalog # AAPs30302) |
Gene Symbol | C3orf67 |
---|---|
Gene Full Name | Chromosome 3 open reading frame 67 |
Alias Symbols | C3orf67 |
NCBI Gene Id | 200844 |
Protein Name | Uncharacterized protein C3orf67 |
Description of Target | The function of the protein remains unknown. |
Uniprot ID | Q6ZVT6 |
Protein Accession # | NP_940865 |
Nucleotide Accession # | NM_198463 |
Protein Size (# AA) | 563 |
Molecular Weight | 63kDa |