TP308560 | CDK6 (NM_001259) Human Recombinant Protein Clinisciences

CDK6 (NM_001259) Human Recombinant Protein

SKU

TP308560

Recombinant protein of human cyclin-dependent kinase 6 (CDK6), 20 µg

MVPro

Full-length human proteins expressed in HEK293T cells

Specifications
Product Data
Species	Human
Expression Host	HEK293T
Expression cDNA Clone or AA Sequence	Protein Sequence >RC208560 protein sequence Red=Cloning site Green=Tags(s) MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLET FEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHR VVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFA EMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKC LTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA myc-FLAG tag
Tag	C-Myc/DDK
Predicted MW	36.8 kDa
Concentration	>0.05 µg/µL as determined by microplate BCA method
Purity	> 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer	25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation	Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note	For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage	Store at -80°C.
Stability	Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping	Dry Ice
Reference Data
RefSeq	NP_001250
Locus ID	1021
UniProt ID	Q00534
Cytogenetics	7q21.2
RefSeq Size	11628
RefSeq ORF	978
Synonyms	MCPH12; PLSTIRE
Summary	The protein encoded by this gene is a member of the CMGC family of serine/threonine protein kinases. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity of this kinase first appears in mid-G1 phase, which is controlled by the regulatory subunits including D-type cyclins and members of INK4 family of CDK inhibitors. This kinase, as well as CDK4, has been shown to phosphorylate, and thus regulate the activity of, tumor suppressor protein Rb. Altered expression of this gene has been observed in multiple human cancers. A mutation in this gene resulting in reduced cell proliferation, and impaired cell motility and polarity, and has been identified in patients with primary microcephaly. [provided by RefSeq, Aug 2017]
Protein Families	Druggable Genome, Protein Kinase
Protein Pathways	Cell cycle, Chronic myeloid leukemia, Glioma, Melanoma, Non-small cell lung cancer, p53 signaling pathway, Pancreatic cancer, Pathways in cancer, Small cell lung cancer

FAQs
Protein FAQs
SDS
SDS for TP308560

Recombinant Protein Resources
Video tutorial: Why protein expression host matters Webinar Video: Overexpression lysate as positive controls for Western blot Product Overview Video: Overexpression lysates as positive controls for Western blot Video Tutorial: Knockout(KO) lysate and antibody specificity Product Brochure: Protein

SKU	Description	Size
PH308560	CDK6 MS Standard C13 and N15-labeled recombinant protein (NP_001250)	10 ug
PH327978	CDK6 MS Standard C13 and N15-labeled recombinant protein (NP_001138778)	10 ug
LC400506	CDK6 HEK293T cell transient overexpression lysate (as WB positive control)	20 ug
LC428809	CDK6 HEK293T cell transient overexpression lysate (as WB positive control)	20 ug
LY400506	Transient overexpression lysate of cyclin-dependent kinase 6 (CDK6), transcript variant 1	100 ug
LY428809	Transient overexpression lysate of cyclin-dependent kinase 6 (CDK6), transcript variant 2	100 ug
TP327978	Purified recombinant protein of Homo sapiens cyclin-dependent kinase 6 (CDK6), 20 µg	20 ug

CDK6 (NM_001259) Human Recombinant Protein

Referência TP308560

Contactar o distribuidor local :

CDK6 (NM_001259) Human Recombinant Protein

Você também pode estar interessado nos seguintes produtos: