NR2F2 Antibody - N-terminal region : Biotin
Referência P100816_P050-Biotin
Tamanho : 100ul
Marca : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-NR2F2 (P100816_P050) antibody |
---|
Publications | Déjardin, J. & Kingston, R. E. Purification of proteins associated with specific genomic Loci. Cell 136, 175-86 (2009). 191358981$s> |
---|---|
Tested Species Reactivity | Human |
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Pig, Rabbit, Sheep, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IHC, WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human NR2F2 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 92%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 92%; Zebrafish: 92% |
Peptide Sequence | Synthetic peptide located within the following region: KVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEP |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-NR2F2 (P100816_P050) antibody is Catalog # AAP31163 (Previous Catalog # AAPS22105) |
Sample Type Confirmation | NR2F2 is supported by BioGPS gene expression data to be expressed in HEK293T |
Reference | Sato,Y., (2003) J. Clin. Endocrinol. Metab. 88 (7), 3415-3420 |
---|---|
Gene Symbol | NR2F2 |
Gene Full Name | Nuclear receptor subfamily 2, group F, member 2 |
Alias Symbols | ARP1, ARP-1, CHTD4, NF-E3, SRXX5, SVP40, COUPTF2, COUPTFB, TFCOUP2, COUPTFII |
NCBI Gene Id | 7026 |
Protein Name | COUP transcription factor 2 |
Description of Target | NR2F2, an orphan member of the nuclear hormone receptor superfamily, acts as a transcriptional repressor by antagonizing the functions of other nuclear hormone receptors and by actively silencing transcription. However, in certain contexts, NR2F2 stimulates transcription directly. NR2F2, MyoD and p300 interact in a competitive manner, and that increasing amounts of NR2F2 have the ability to reduce the interaction between myoD and p300 invitro. NR2F2 post-transcriptionally regulates myoD activity/function, and that crosstalk between orphan nuclear receptors and the myogenic bHLH proteins has functional consequences for differentiation. |
Uniprot ID | P24468 |
Protein Accession # | NP_066285 |
Nucleotide Accession # | NM_021005 |
Protein Size (# AA) | 414 |
Molecular Weight | 45kDa |
Protein Interactions | NSD1; BCL11A; NR2F2; BIK; SETD7; FAM46A; HIPK3; UBC; TFAP4; Cebpb; SMARCAD1; NR2F6; POU5F1; NR3C1; PHB2; TRIP4; PIAS1; BCL11B; TRIM24; EP300; SQSTM1; HDAC1; NCOR2; MYOD1; LCK; |