SCMH1 Antibody - middle region

Referência ARP31693_P050-25UL

Tamanho : 25ul

Marca : Aviva Systems Biology

Solicitar mais informações

Contactar o distribuidor local :


Telefone : +1 850 650 7790

SCMH1 Antibody - middle region (ARP31693_P050)

Datasheets/ManualsPrintable datasheet for anti-SCMH1 (ARP31693_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Rabbit, Yeast
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SCMH1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 86%; Yeast: 79%
Peptide SequenceSynthetic peptide located within the following region: LTGDNLQPPGTKVVIPKNPYPASDVNTEKPSIHSSTKTVLEHQPGQRGRK
Concentration0.5 mg/ml
Blocking PeptideFor anti-SCMH1 (ARP31693_P050) antibody is Catalog # AAP31693 (Previous Catalog # AAPP02480)
ReferenceOlsen,J.V., (2006) Cell 127 (3), 635-648
Gene SymbolSCMH1
Gene Full NameSex comb on midleg homolog 1 (Drosophila)
Alias SymbolsScml3
NCBI Gene Id22955
Protein NamePolycomb protein SCMH1
Description of TargetSCMH1 is a component of the Polycomb group (PcG) multiprotein PRC1 complex, a complex required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility.
Uniprot IDQ96GD3-4
Protein Accession #NP_036368
Nucleotide Accession #NM_012236
Protein Size (# AA)591
Molecular Weight65kDa
Protein InteractionsUBQLN1; RNF2; MAGEA12; BMI1; UBQLN4; PHC3; CBX4; PCGF2; PHC2; PHC1; MAML3; LZTR1; PCBD1; EWSR1; TMEM11; SCMH1; MOB4; TOB1; POLR2M; LYPLA2; GMNN; HK1; Cbx2;