SMPX, Recombinant, Human, aa1-88, GST-Tag (Small Muscular Protein)

Plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair.||Source:|Recombinant protein corresponding to aa1-88 from human SMPX, fused to GST-Tag at N-terminal expressed in E. coli.||Molecular Weight: |~36.6kD||Amino Acid Sequence:|MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.