TEAD4 Antibody - C-terminal region
Referência ARP38276_P050-25UL
Tamanho : 25ul
Marca : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-TEAD4 (ARP38276_P050) antibody |
---|
Publications | Identification of Quinolinols as Activators of TEAD-Dependent Transcription. ACS Chem Biol. 14, 2909-2921 (2019). 317429951$s> Ribas, R. et al. Members of the TEAD family of transcription factors regulate the expression of Myf5 in ventral somitic compartments. Dev. Biol. 355, 372-80 (2011). 215272581$s> Screening with a novel cell-based assay for TAZ activators identifies a compound that enhances myogenesis in C2C12 cells and facilitates muscle repair in a muscle injury model. Mol Cell Biol. 34, 1607-21 (2014). 245500071$s> | ||||||
---|---|---|---|---|---|---|---|
Tested Species Reactivity | Human | ||||||
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish | ||||||
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | ||||||
Clonality | Polyclonal | ||||||
Host | Rabbit | ||||||
Application | IHC, WB | ||||||
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. | ||||||
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TEAD4 | ||||||
Purification | Affinity Purified | ||||||
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% | ||||||
Peptide Sequence | Synthetic peptide located within the following region: MMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE | ||||||
Concentration | 0.5 mg/ml | ||||||
Blocking Peptide | For anti-TEAD4 (ARP38276_P050) antibody is Catalog # AAP38276 (Previous Catalog # AAPP20485) | ||||||
Sample Type Confirmation | TEAD4 is supported by BioGPS gene expression data to be expressed in HEK293T | ||||||
Enhanced Validation |
|
Reference | Chen,H.H., et al., (2004) Circulation 110 (19), 2980-2987 |
---|---|
Gene Symbol | TEAD4 |
Gene Full Name | TEA domain family member 4 |
Alias Symbols | TEF3, RTEF1, TEF-3, EFTR-2, TEFR-1, TCF13L1, hRTEF-1B |
NCBI Gene Id | 7004 |
Protein Name | Transcriptional enhancer factor TEF-3 |
Description of Target | TEAD4 is a member of the transcriptional enhancer factor (TEF) family. The family members contain the TEA/ATTS DNA-binding domain. TEAD4 is preferentially expressed in skeletal muscle, and binds to the M-CAT regulatory element which directs muscle-specific gene expression. TEAD4 is encoded through the use of a non-AUG (TTG) translation initiation codon. This gene encodes a member of the transcriptional enhancer factor (TEF) family. The family members contain the TEA/ATTS DNA-binding domain. This member is preferentially expressed in skeletal muscle, and binds to the M-CAT regulatory element which directs muscle-specific gene expression. The protein is encoded through the use of a non-AUG (TTG) translation initiation codon. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
Uniprot ID | Q96BK2 |
Protein Accession # | NP_003204 |
Nucleotide Accession # | NM_003213 |
Protein Size (# AA) | 434 |
Molecular Weight | 48kDa |
Protein Interactions | CCDC172; SSX2IP; LZTS2; CEP70; CEP55; RABGEF1; CCNDBP1; KIAA0753; PNMA1; TRAF1; VPS52; TRIM27; GOLGA2; UBC; SUMO2; CCDC85B; WWTR1; YAP1; VGLL1; MYH7; |