AHNAK2 Rabbit Polyclonal Antibody
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-AHNAK2 antibody: synthetic peptide directed towards the middle region of human AHNAK2. Synthetic peptide located within the following region: AATRVCRTGRSRWRDVCRNFMRRYQSRVIQGLVAGETAQQICEDLRLCIP |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 85 kDa |
Gene Name | AHNAK nucleoprotein 2 |
Database Link | |
Background | The specific function of AHNAK2 is not yet known. |
Synonyms | C14orf78 |
Note | Immunogen sequence homology: Human: 100%; Yeast: 83% |
Reference Data |
Documents
Product Manuals |
FAQs |
|
SDS |
Resources
Antibody Resources |
|