AHSP (Alpha-hemoglobin-stabilizing Protein, EDRF, ERAF, Erythroid Associated Factor, Erythroid Differentiation-related Factor) (HRP)

AHSP (Alpha-hemoglobin stabilizing protein), also known as ERAF (Erythroid associated factor), is an erythroid-specific protein that acts as a chaperone to prevent the aggregation of aplha-hemoglobin during normal erythroid cell development. It specifically protects free alpha-hemoglobin from precipitation in live cells and in solution. This protein is downregulated in transmissible spongiform encephalopathies (TSEs). It is predicted to modulate pathological states of alpha-hemoglobin excess such as beta-thalassemia. Recombinant AHSP protein, expressed in E. coli and purified by using conventional chromatography techniques.||Applications:|Suitable for use in ELISA and Western Blot. Other applications not tested.||Recommended Dilutions:|Optimal dilutions to be determined by the researcher.||Amino Acid Sequence:|MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS||Storage and Stability:|Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.||Note: Applications are based on unconjugated antibody.