CRBN Antibody - N-terminal region : HRP

Referência ARP56882_P050-HRP

Tamanho : 100ul

Marca : Aviva Systems Biology

Contactar o distribuidor local :


Telefone : +1 850 650 7790
Datasheets/ManualsPrintable datasheet for anti-CRBN (ARP56882_P050) antibody
Product Info
Publications

HDAC6â , 499-512 (2019). 3126815624206017

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CRBN
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: DQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVL
Concentration0.5 mg/ml
Blocking PeptideFor anti-CRBN (ARP56882_P050) antibody is Catalog # AAP56882 (Previous Catalog # AAPP39828)
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Reference0
Gene SymbolCRBN
Gene Full NameCereblon
Alias SymbolsMRT2, MRT2A
NCBI Gene Id51185
Protein NameProtein cereblon
Description of TargetThis gene encodes a protein related to the Lon protease protein family. In rodents and other mammals this gene product is found in the cytoplasm localized with a calcium channel membrane protein, and is thought to play a role in brain development. Mutatio
Uniprot IDQ96SW2
Protein Accession #NP_057386
Nucleotide Accession #NM_016302
Protein Size (# AA)442
Molecular Weight50 kDa
Protein InteractionsPAK7; RBPMS; MEIS2; DDB1; IKZF3; IKZF1; SUV39H1; KDM1A; UBC; COPS4; COPS6; COPS3; PSMB4; PSMA2; COPS5; CUL4A; PRKAA1; RBX1;
  1. What is the species homology for "CRBN Antibody - N-terminal region (ARP56882_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "CRBN Antibody - N-terminal region (ARP56882_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CRBN Antibody - N-terminal region (ARP56882_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CRBN Antibody - N-terminal region (ARP56882_P050)"?

    This target may also be called "MRT2, MRT2A" in publications.

  5. What is the shipping cost for "CRBN Antibody - N-terminal region (ARP56882_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "CRBN Antibody - N-terminal region (ARP56882_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CRBN Antibody - N-terminal region (ARP56882_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "50 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CRBN Antibody - N-terminal region (ARP56882_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CRBN"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CRBN"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CRBN"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CRBN"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CRBN"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CRBN"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.