EN1 Antibody - C-terminal region : Biotin
Referência P100923_P050-Biotin
Tamanho : 100ul
Marca : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-EN1 (P100923_P050) antibody |
---|
Publications | Beltran, A. S., Graves, L. M. & Blancafort, P. Novel role of Engrailed 1 as a prosurvival transcription factor in basal-like breast cancer and engineering of interference peptides block its oncogenic function. Oncogene. doi:10.1038/onc.2013.422 (2013). 24141779 |
---|---|
Tested Species Reactivity | Human |
Predicted Species Reactivity | Guinea Pig, Rabbit |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human EN1 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Guinea Pig: 93%; Rabbit: 86% |
Peptide Sequence | Synthetic peptide located within the following region: LMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEK |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-EN1 (P100923_P050) antibody is Catalog # AAP31276 (Previous Catalog # AAPP02025) |
Reference | Atit,R., (2006) Dev. Biol. 296 (1), 164-176 |
---|---|
Gene Symbol | EN1 |
Gene Full Name | Engrailed homeobox 1 |
Alias Symbols | ENDOVESLB |
NCBI Gene Id | 2019 |
Protein Name | Homeobox protein engrailed-1 |
Description of Target | Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Uniprot ID | Q05925 |
Protein Accession # | NP_001417 |
Nucleotide Accession # | NM_001426 |
Protein Size (# AA) | 392 |
Molecular Weight | 40kDa |
Protein Interactions | TLE1; PAX6; JUN; |
-
What is the species homology for "EN1 Antibody - C-terminal region (P100923_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Guinea Pig, Rabbit".
-
How long will it take to receive "EN1 Antibody - C-terminal region (P100923_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "EN1 Antibody - C-terminal region (P100923_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "EN1 Antibody - C-terminal region (P100923_P050)"?
This target may also be called "ENDOVESLB" in publications.
-
What is the shipping cost for "EN1 Antibody - C-terminal region (P100923_P050)"?
The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.
-
What is the guarantee for "EN1 Antibody - C-terminal region (P100923_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "EN1 Antibody - C-terminal region (P100923_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "40kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "EN1 Antibody - C-terminal region (P100923_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "EN1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "EN1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "EN1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "EN1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "EN1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "EN1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.