HSD3B1 Antibody - N-terminal region : Biotin

Referência ARP41821_P050-Biotin

Tamanho : 100ul

Marca : Aviva Systems Biology

Solicitar mais informações

Contactar o distribuidor local :


Telefone : +1 850 650 7790

HSD3B1 Antibody - N-terminal region (ARP41821_P050)

Rating:
90% of 100
Datasheets/ManualsPrintable datasheet for anti-HSD3B1 (ARP41821_P050) antibody
Product Info
Publications

Dual targeting of androgen receptor and mTORC1 by salinomycin in prostate cancer. Oncotarget. 7, 62240-62254 (2016). 27557496

More...

Tested Species ReactivityHuman, Monkey
Predicted Species ReactivityHuman, Goat, Monkey
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HSD3B1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceGoat: 82%; Human: 100%; Monkey: 92%
Peptide SequenceSynthetic peptide located within the following region: TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-HSD3B1 (ARP41821_P050) antibody is Catalog # AAP41821 (Previous Catalog # AAPP10869)
ReferenceRoss,R.W., (2008) J. Clin. Oncol. 26 (6), 842-847
Gene SymbolHSD3B1
Gene Full NameHydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1
Alias SymbolsHSD3B, HSDB3, HSDB3A, SDR11E1, 3BETAHSD
NCBI Gene Id3283
Protein Name3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1
Description of Target3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.
Uniprot IDP14060
Protein Accession #NP_000853
Nucleotide Accession #NM_000862
Protein Size (# AA)373
Molecular Weight42kDa