LGR5 Antibody : FITC
Referência ARP59640_P050-FITC
Tamanho : 100ul
Marca : Aviva Systems Biology
LGR5 Antibody - middle region (ARP59640_P050)
Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/Manuals | Printable datasheet for anti-LGR5 (ARP59640_P050) antibody |
---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Horse, Pig, Rabbit |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IHC |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence KKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 93%; Horse: 92%; Human: 100%; Mouse: 93%; Pig: 77%; Rabbit: 93%; Rat: 93% |
Peptide Sequence | Synthetic peptide located within the following region: KKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG |
Concentration | 0.5 mg/ml |
Blocking Peptide | Available upon request |
Gene Symbol | LGR5 |
---|---|
Gene Full Name | leucine-rich repeat containing G protein-coupled receptor 5 |
Alias Symbols | FEX, HG38, GPR49, GPR67, GRP49 |
NCBI Gene Id | 8549 |
Protein Name | Leucine-rich repeat-containing G-protein coupled receptor 5 |
Uniprot ID | O75473 |
Protein Accession # | NP_003658 |
Nucleotide Accession # | NM_003667 |
Protein Size (# AA) | 907 |
Molecular Weight | 100 kDa |
Protein Interactions | Znrf3; |