LHX1 Antibody - C-terminal region : FITC
Referência P100851_T100-FITC
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
LHX1 Antibody - C-terminal region (P100851_T100)
| Datasheets/Manuals | Printable datasheet for anti-LHX1 (P100851_T100) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human LHX1 |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 85% |
| Peptide Sequence | Synthetic peptide located within the following region: PEPSLPGPLHSMSAEVFGPSPPFSSLSVNGGASYGNHLSHPPEMNEAAVW |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-LHX1 (P100851_T100) antibody is Catalog # AAP31210 (Previous Catalog # AAPP01954) |
| Reference | Phillips,J.C. et al., (2002) Cytogenet. Genome Res. 97:140D-O |
|---|---|
| Gene Symbol | LHX1 |
| Gene Full Name | LIM homeobox 1 |
| Alias Symbols | LIM1, LIM-1 |
| NCBI Gene Id | 3975 |
| Protein Name | LIM/homeobox protein Lhx1 |
| Description of Target | LHX1 is a member of a large protein family which contains the LIM domain, a unique cysteine-rich zinc-binding domain. It may function as a transcriptional regulator and be involved in control of differentiation and development of neural and lymphoid cells. A similar protein in mice is an essential regulator of the vertebrate head organizer. |
| Uniprot ID | P48742 |
| Protein Accession # | NP_005559 |
| Nucleotide Accession # | NM_005568 |
| Protein Size (# AA) | 406 |
| Molecular Weight | 45kDa |
| Protein Interactions | ISL1; RLIM; LHX3; OTX2; FOXA2; |
