PAX7 Antibody - C-terminal region

Referência ARP32742_P050

Tamanho : 100ul

Marca : Aviva Systems Biology

Solicitar mais informações

Contactar o distribuidor local :


Telefone : +1 850 650 7790

PAX7 Antibody - C-terminal region (ARP32742_P050)

Datasheets/ManualsPrintable datasheet for anti-PAX7 (ARP32742_P050) antibody
Product Info
Publications

A collagen domain-derived short adiponectin peptide activates APPL1 and AMPK signaling pathways and improves glucose and fatty acid metabolisms. J Biol Chem. 293, 13509-13523 (2018). 2999159226242746

Cell cycle regulation of embryonic stem cells and mouse embryonic fibroblasts lacking functional Pax7. Cell Cycle. 15, 2931-2942 (2016). 276109332313639426359239

More...

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of PAX7
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: QADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTT
Concentration0.5 mg/ml
Blocking PeptideFor anti-PAX7 (ARP32742_P050) antibody is Catalog # AAP32742
Gene SymbolPAX7
Gene Full NamePaired box 7
Alias SymbolsHUP1, RMS2, PAX7B, MYOSCO
NCBI Gene Id5081
Protein NamePaired box protein Pax-7
Description of TargetPAX7 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box gene 7 is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Alternative splicing in this gene has produced two known products but the biological significance of the variants is unknown.
Uniprot IDP23759
Protein Accession #NP_002575
Nucleotide Accession #NM_002584
Protein Size (# AA)520
Molecular Weight57kDa
Protein InteractionsTRIM27; MYOD1; Dlg4; WDR5; ASH2L; HIRA; Ubc;