RpsF, Recombinant, E. coli, aa1-131, GST-Tag (30S Ribosomal Protein S6)
Referência 375149-100ug
Tamanho : 100ug
Marca : US Biological
375149 RpsF, Recombinant, E. coli, aa1-131, GST-Tag (30S Ribosomal Protein S6)
Clone Type
PolyclonalSwiss Prot
P02358Grade
PurifiedShipping Temp
Blue IceStorage Temp
-20°CBinds together with S18 to 16S ribosomal RNA.||Source:|Recombinant protein corresponding to aa1-131 from E. coli rpsF, fused to GST-Tag at N-terminal, expressed in E. coli. ||Molecular Weight: |~42.2kD||Amino Acid Sequence:|MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANETADDAEAGDSEE||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Applications
Source: Recombinant, E. coli|Purity: ≥90% (SDS-PAGE)|Concentration: As Reported |Form: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.
Purity
≥90% (SDS-PAGE)