Sst antibody - N-terminal region

Referência ARP41905_P050

Tamanho : 100ul

Marca : Aviva Systems Biology

Solicitar mais informações

Contactar o distribuidor local :


Telefone : +1 850 650 7790
Datasheets/ManualsPrintable datasheet for anti-Sst (ARP41905_P050) antibody
Product Info
Tested Species ReactivityRat
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Peptide SequenceSynthetic peptide located within the following region: LQKSLAAATGKQELAKYFLAELLSEPNQTENDALEPEDLPQAAEQDEMRL
Concentration0.5 mg/ml
Blocking PeptideFor anti-Sst (ARP41905_P050) antibody is Catalog # AAP41905
Gene SymbolSst
Gene Full NameSomatostatin
Alias SymbolsS, SS, Sm, SOM, SRIF, Smst
NCBI Gene Id20604
Protein NameSomatostatin
Description of TargetSomatostatin inhibits the release of somatotropin.
Uniprot IDP60041
Protein Accession #NP_033241
Nucleotide Accession #NM_009215
Protein Size (# AA)116
Molecular Weight13kDa
  1. What is the species homology for "Sst Antibody - N-terminal region (ARP41905_P050)"?

    The tested species reactivity for this item is "Rat". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep".

  2. How long will it take to receive "Sst Antibody - N-terminal region (ARP41905_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Sst Antibody - N-terminal region (ARP41905_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Sst Antibody - N-terminal region (ARP41905_P050)"?

    This target may also be called "S, SS, Sm, SOM, SRIF, Smst" in publications.

  5. What is the shipping cost for "Sst Antibody - N-terminal region (ARP41905_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "Sst Antibody - N-terminal region (ARP41905_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Sst Antibody - N-terminal region (ARP41905_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "13kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Sst Antibody - N-terminal region (ARP41905_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SST"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SST"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SST"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SST"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SST"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SST"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Você também pode estar interessado nos seguintes produtos:



Referência
Descrição
Cond.
Price Bef. VAT