Stabilin 1 (Stabilin-1, STAB1, STAB-1, Fasciclin, EGF-like, Laminin-type EGF-like and Link Domain-containing Scavenger Receptor 1, FEEL1, FEEL-1, FELE-1, CLEVER-1, FEX1, KIAA0246, MS-1 Antigen) (PE)
Referência 133908-PE-100ul
Tamanho : 100ul
Marca : US Biological
133908-PE Rabbit Anti-Stabilin 1 (Stabilin-1, STAB1, STAB-1, Fasciclin, EGF-like, Laminin-type EGF-like and Link Domain-containing Scavenger Receptor 1, FEEL1, FEEL-1, FELE-1, CLEVER-1, FEX1, KIAA0246, MS-1 Antigen) (PE)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgG2a,kGrade
Affinity PurifiedApplications
FLISA IF WBCrossreactivity
HuAccession #
NM_015136; NP_055951Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeApplications:|Suitable for use in FLISA, Immunofluorescence and Western Blot. Other applications have not been tested. ||Recommended Dilutions:|Optimal dilutions to be determined by the researcher.||Amino Acid Sequence:|EALASDLPNLGPLRTMHGTPISFSCSRTRAGELMVGEDDARIVQRHLPFEGGLAYGIDQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQ||Storage and Stability:|Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.||Note: Applications are based on unconjugated antibody.