TCF12 Antibody - N-terminal region : HRP
Referência P100771_P050-HRP
Tamanho : 100ul
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
TCF12 Antibody - N-terminal region (P100771_P050)
| Datasheets/Manuals | Printable datasheet for anti-TCF12 (P100771_P050) antibody |
|---|
| Tested Species Reactivity | Human, Mouse |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Cow, Pig, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TCF12 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Zebrafish: 92% |
| Peptide Sequence | Synthetic peptide located within the following region: QQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGIDE |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-TCF12 (P100771_P050) antibody is Catalog # AAP31099 (Previous Catalog # AAPS32601) |
| Reference | Zhang,J., et al., (2004) Science 305 (5688), 1286-1289 |
|---|---|
| Gene Symbol | TCF12 |
| Gene Full Name | Transcription factor 12 |
| Alias Symbols | HEB, p64, CRS3, HTF4, TCF-12, bHLHb20, HsT17266 |
| NCBI Gene Id | 6938 |
| Protein Name | Transcription factor 12 |
| Description of Target | TCF12 encodes a protein that is a member of the basic helix-loop-helix (bHLH) E-protein family which recognizes the consensus binding site (E-box) CANNTG. This encoded protein is expressed in many tissues, among them skeletal muscle, thymus, B- and T-cells, and may participate in regulating lineage-specific gene expression through the formation of heterodimers with other bHLH E-proteins.The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH) E-protein family that recognizes the consensus binding site (E-box) CANNTG. This encoded protein is expressed in many tissues, among them skeletal muscle, thymus, B- and T-cells, and may participate in regulating lineage-specific gene expression through the formation of heterodimers with other bHLH E-proteins. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. |
| Uniprot ID | Q99081 |
| Protein Accession # | NP_996919 |
| Nucleotide Accession # | NM_207036 |
| Protein Size (# AA) | 706 |
| Molecular Weight | 73kDa |
| Protein Interactions | TSNAX; STAT5A; SRI; RNASEL; QARS; PSMA1; MLLT6; ID3; CDKN2C; TRIM72; LYSMD1; C6orf165; HEXIM2; ASCL4; MORN4; TWIST2; C16orf45; HOPX; NAGK; C1orf109; SPG21; VPS28; NEUROG3; OSGIN1; CRCP; EDRF1; ARMC8; MAPKBP1; STK16; DGCR6; UBC; TCF21; SOX2; ID2; BMF; MYC; |
