tmk Recombinant Protein
Referência OPCA03316-20UG
Tamanho : 20ug
Marca : Aviva Systems Biology
Contactar o distribuidor local :
Telefone : +1 850 650 7790
TMK Recombinant Protein (Mycobacterium tuberculosis) (OPCA03316)
| Datasheets/Manuals | Printable datasheet for TMK Recombinant Protein (Mycobacterium tuberculosis) (OPCA03316) (OPCA03316) |
|---|
| Predicted Species Reactivity | Mycobacterium tuberculosis |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Host | Mycobacterium tuberculosis |
| Additional Information | Relevance: Catalyzes the reversible phosphorylation of deoxythymidine monophosphate (dTMP) to deoxythymidine diphosphate (dTDP), using ATP as its preferred phosphoryl donor. Situated at the junction of both de novo and salvage pathways of deoxythymidine triphosphate (dTTP) synthesis, is essential for DNA synthesis and cellular growth |
| Reconstitution and Storage | -20°C or -80°C |
| Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLAPPDVPS |
| Protein Sequence | MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLAPPDVPS |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 1-214 aa |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Reference | Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains.Fleischmann R.D., Alland D., Eisen J.A., Carpenter L., White O., Peterson J.D., DeBoy R.T., Dodson R.J., Gwinn M.L., Haft D.H., Hickey E.K., Kolonay J.F., Nelson W.C., Umayam L.A., Ermolaeva M.D., Salzberg S.L., Delcher A., Utterback T.R. Fraser C.M.J. Bacteriol. 184:5479-5490(2002) |
|---|---|
| Gene Symbol | TMK |
| Alias Symbols | dTMP kinase;Thymidine monophosphate kinase. |
| Protein Name | Thymidylate kinase |
| Description of Target | Catalyzes the reversible phosphorylation of deoxythymidine monophosphate (dTMP) to deoxythymidine diphosphate (dTDP), using ATP as its preferred phosphoryl donor. Situated at the junction of both de novo and salvage pathways of deoxythymidine triphosphate (dTTP) synthesis, is essential for DNA synthesis and cellular growth (By similarity). |
| Uniprot ID | P9WKE0 |
| Protein Accession # | WP_003417036.1 |
| Nucleotide Accession # | NZ_KK341227.1 |
| Protein Size (# AA) | Recombinant |
| Molecular Weight | 38.6 kDa |