UBR3 Antibody : HRP

Referência ARP43449_P050-HRP

Tamanho : 100ul

Marca : Aviva Systems Biology

Solicitar mais informações

Contactar o distribuidor local :


Telefone : +1 850 650 7790

UBR3 Antibody - C-terminal region (ARP43449_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-UBR3 (ARP43449_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human UBR3
PurificationAffinity purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: SQNCGAGTGIFLLINASVIIIIRGHRFCLWGSVYLDAHGEEDRDLRRGKP
Concentration0.5 mg/ml
Blocking PeptideFor anti-UBR3 (ARP43449_P050) antibody is Catalog # AAP43449
Gene SymbolUBR3
Gene Full Nameubiquitin protein ligase E3 component n-recognin 3 (putative)
Alias SymbolsZNF650
NCBI Gene Id130507
Protein NameE3 ubiquitin-protein ligase UBR3
Description of TargetE3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Does not bind to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.
Uniprot IDQ6ZT12-3
Protein Size (# AA)43
Molecular Weight394
Protein InteractionsDZIP3; UBC; UBE2Z; UBE2B; UBE2A;