Taar3 Blocking peptide (Middle region)

Cat# AAP94117

Size : 100ug

Brand : Aviva Systems Biology

Contact local distributor :


Phone : +1 850 650 7790

TAAR3 Peptide - middle region (AAP94117)

Data Sheet
 
Sku AAP94117
99
Name TAAR3 Peptide - middle region (AAP94117)
Purchase info To purchase this peptide:
  • Copy peptide #
  • Click on this link
  • Paste into field 'Peptide Number'
Size 100ug
Gene TAAR3
Gene id 493809
Description of target Olfactory receptor activated by several primary trace amines, including isoamylamine. Activated by isoamylamine and cyclohexylamine, but not to the corresponding alcohols, isoamylalcohol and cyclohexanol. This receptor is probably mediated by the G(s)-class of G-proteins which activate adenylate cyclase (By similarity).
Swissprot id Q5QD24
Protein accession num NP_001008429.1
Nucleotide accession num NM_001008429.1
Protein size 342 amino acids
Molecular weight 37 kDa
Species reactivity Rat
Peptide sequence Synthetic peptide located within the following region: GKNLSKKKDRKAAKTLGIVMGVFLACWLPCFLAVLIDPYLDYSTPIIVLD
Quality control The peptide is characterized by mass spectroscopy
Description This is a synthetic peptide designed for use in combination with anti- TAAR3 Antibody (ARP94117_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery International: 3-5 business days
Protocol
  • Reconstitution Instructions
  • Immunohistochemistry (IHC) Protocol
  • Immunocytochemistry (ICC) Protocol
  • Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
  • Western Blotting/Immunoblotting (WB/IB) Protocol
  • Blocking Peptide Competition Protocol (BPCP)
  • Immunoprecipitation (IP) Protocol
Tips
  • IHC Tips & Tricks
  • ICC Tips & Tricks
  • ELISA Tips & Tricks
  • WB/IB Tips & Tricks
  • IP Tips & Tricks

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com