SOX9 Peptide - middle region

Cat# AAP86779

Size : 100ug

Marca : Aviva Systems Biology

Contatta il distributore locale :


Telefono : +1 850 650 7790

SOX9 Peptide - middle region (AAP86779)

Data Sheet
 
Sku AAP86779
99
Name SOX9 Peptide - middle region (AAP86779)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene SOX9
Alias symbols CMD1, SRA1, CMPD1, SRXX2, SRXY10
Gene id 6662
Description of target The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal.
Swissprot id P56693-2
Protein accession num NP_000337.1
Nucleotide accession num NM_000346.3
Protein size 286 amino acids
Molecular weight 31 kDa
Species reactivity Human
Peptide sequence Synthetic peptide located within the following region: NESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRKSVKNGQAEAEEATEQT
Quality control The peptide is characterized by mass spectroscopy
Description This is a synthetic peptide designed for use in combination with anti- SOX9 Antibody (ARP86779_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery International: 3-5 business days
Protocol
  • Reconstitution Instructions
  • Immunohistochemistry (IHC) Protocol
  • Immunocytochemistry (ICC) Protocol
  • Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
  • Western Blotting/Immunoblotting (WB/IB) Protocol
  • Blocking Peptide Competition Protocol (BPCP)
  • Immunoprecipitation (IP) Protocol
Tips
  • IHC Tips & Tricks
  • ICC Tips & Tricks
  • ELISA Tips & Tricks
  • WB/IB Tips & Tricks
  • IP Tips & Tricks

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com